1.67 Rating by CuteStat

sportlenon.com is 1 decade 1 month old. It is a domain having com extension. It has a global traffic rank of #14742357 in the world. This website is estimated worth of $ 8.95 and have a daily income of around $ 0.15. As no active threats were reported recently by users, sportlenon.com is SAFE to browse.

PageSpeed Score
84
Siteadvisor Rating
Not Applicable

Traffic Report

Daily Unique Visitors: 33
Daily Pageviews: 66

Estimated Valuation

Income Per Day: $ 0.15
Estimated Worth: $ 8.95

Search Engine Indexes

Google Indexed Pages: Not Applicable
Bing Indexed Pages: Not Applicable

Search Engine Backlinks

Google Backlinks: Not Applicable
Bing Backlinks: Not Applicable

Safety Information

Google Safe Browsing: No Risk Issues
Siteadvisor Rating: Not Applicable
WOT Trustworthiness: Not Applicable
WOT Child Safety: Not Applicable

Website Ranks & Scores

Alexa Rank: 14,742,357
Domain Authority: Not Applicable

Web Server Information

Hosted IP Address:

91.237.88.232

Hosted Country:

Germany DE

Location Latitude:

49.015

Location Longitude:

12.0956

Page Resources Breakdown

Homepage Links Analysis

Website Inpage Analysis

H1 Headings: 1 H2 Headings: Not Applicable
H3 Headings: Not Applicable H4 Headings: Not Applicable
H5 Headings: Not Applicable H6 Headings: Not Applicable
Total IFRAMEs: Not Applicable Total Images: Not Applicable
Google Adsense: Not Applicable Google Analytics: Not Applicable

Websites Hosted on Same IP (i.e. 91.237.88.232)

quicksilverscreen.ch

- quicksilverscreen.ch
Not Applicable $ 8.95

403 Forbidden

- measesso.com
Not Applicable $ 8.95

403 Forbidden

- pornhublove.com
Not Applicable $ 8.95

403 Forbidden

- cookpd.com
Not Applicable $ 8.95

403 Forbidden

- hostmonstre.com
Not Applicable $ 8.95

HTTP Header Analysis

HTTP/1.1 403 Forbidden
Server: nginx
Date: Fri, 28 Mar 2014 01:11:33 GMT
Content-Type: text/html
Content-Length: 162
Connection: keep-alive

Domain Information

Domain Registrar: Everest 23, LLC
Registration Date: Mar 21, 2014, 12:00 AM 1 decade 1 month 6 days ago
Last Modified: Mar 21, 2014, 12:00 AM 1 decade 1 month 6 days ago
Expiration Date: Mar 21, 2015, 12:00 AM 9 years 1 month 5 days ago
Domain Status:
ok

Domain Nameserver Information

Host IP Address Country
ns1.parkingcrew.net 13.248.158.159 United States of America United States of America
ns2.parkingcrew.net 76.223.21.9 United States of America United States of America

DNS Record Analysis

Host Type TTL Extra
sportlenon.com A 594 IP: 91.237.88.232
sportlenon.com NS 3599 Target: ns2.parkingcrew.net
sportlenon.com NS 3599 Target: ns1.parkingcrew.net
sportlenon.com SOA 10799 MNAME: ns1.parkingcrew.net
RNAME: hostmaster.sportlenon.com
Serial: 1395965558
Refresh: 28800
Retry: 7200
Expire: 604800
Minimum TTL: 86400

Similarly Ranked Websites

Little Owl | Preschool – DaycareLittle Owl

- littleowl-indonesia.com
14,742,375 $ 8.95

Watch Movies Online Streaming and Download - WatchMoviesKay

- watchmovieskay.net

Browse movies at watchmovieskay.net. You can watch and download as much movies as you want The Jungle Book,Term Life,Ratchet & Clank

14,742,383 $ 8.95


Certifed Female Friendly Around Thousand Oaks, CA | Certified Female F

- askpattycertifiedfemalefriendly.com
14,742,507 $ 8.95

Autism Sunday - Home

- autismsunday.co.uk
14,742,508 $ 8.95

Full WHOIS Lookup

Domain Name: SPORTLENON.COM
Registry Domain ID: 1851458538_DOMAIN_COM-VRSN
Registrar WHOIS Server: whois.yourjungle.com
Registrar URL: https://secure.bellnames.com
Updated Date: 2014-03-27
Creation Date: 2014-03-21
Registrar Registration Expiration Date: 2015-03-21
Registrar: Threadtrade.com, Inc.
Registrar IANA ID: 1027
Registrar Abuse Contact Email: abuse@bellnames.com
Registrar Abuse Contact Phone: +1.720.921.8850
Domain Status: ok
Registry Registrant ID:
Registrant Name: Whois Agent
Registrant Organization: YourJungle Privacy Protection Service
Registrant Street: 6140 Tutt Blvd, #160
Registrant City: Colorado Springs
Registrant State/Province: CO
Registrant Postal Code: 80923
Registrant Country: US
Registrant Phone: 1.720.921.8850
Registrant Phone Ext:
Registrant Fax:
Registrant Fax Ext:
Registrant Email:sportlenon.com@yourjungleprivacy.com
Registry Admin ID:
Admin Name: Whois Agent
Admin Organization: YourJungle Privacy Protection Service
Admin Street: 6140 Tutt Blvd, #160
Admin City: Colorado Springs
Admin State/Province: CO
Admin Postal Code: 80923
Admin Country: US
Admin Phone: +1.720.921.8850
Admin Phone Ext:
Admin Fax:
Admin Fax Ext:
Admin Email:sportlenon.com@yourjungleprivacy.com
Registry Tech ID:
Tech Name: Whois Agent
Tech Organization: BellNames Privacy Protection Service
Tech Street: 6140 Tutt Blvd, #160
Tech City: Colorado Springs
Tech State/Province: CO
Tech Postal Code: 80923
Tech Country: US
Tech Phone: +1.720.921.8850
Tech Phone Ext:
Tech Fax:
Tech Fax Ext:
Tech Email:sportlenon.com@yourjungleprivacy.com
Name Server: NS1.PARKINGCREW.NET
Name Server: NS2.PARKINGCREW.NET
DNSSEC: unsigned
URL of the ICANN WHOIS Data Problem Reporting System: http://wdprs.internic.net/